Recombinant Full Length Human LRRC19 Protein

• Cat.No.: LRRC19-5947HF
• Product Overview: Human LRRC19 full-length ORF (ADR82971.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 369 amino acids
• Description: LRRC19 (Leucine Rich Repeat Containing 19) is a Protein Coding gene.
• Form: Liquid
• Molecular Mass: 40.7 kDa
• AA Sequence: MKVTGITILFWPLSMILLSDKIQSSKREVQCNFTEKNYTLIPADIKKDVTILDLSYNQITLNGTDTRVLQTYFLLTELYLIENKVTILHNNGFGNLSSLEILNICRNSIYVIQQGAFLGLNKLKQLYLCQNKIEQLNADVFVPLRSLKLLNLQGNLISYLDVPPLFHLELITLYGNLWNCSCSLFNLQNWLNTSNVTLENENITMCSYPNSLQSYNIKTVPHKAECHSKFPSSVTEDLYIHFQPISNSIFNSSSNNLTRNSEHEPLGKSWAFLVGVVVTVLTTSLLIFIAIKCPIWYNILLSYNHHRLEEHEAETYEDGFTGNPSSLSQIPETNSEETTVIFEQLHSFVVDDDGFIEDKYIDIHELCEEN
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: LRRC19 leucine rich repeat containing 19 [ Homo sapiens ]
• Official Symbol: LRRC19
• Synonyms: LRRC19; leucine rich repeat containing 19; leucine-rich repeat-containing protein 19; FLJ21302
• Gene ID: 64922
• mRNA Refseq: NM_022901
• Protein Refseq: NP_075052
• MIM: 619068
• UniProt ID: Q9H756