Recombinant Human LRRC19 Protein

Cat.No. : LRRC19-4681H
Product Overview : Human LRRC19 full-length ORF (ADR82971.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : LRRC19 (Leucine Rich Repeat Containing 19) is a Protein Coding gene.
Form : Liquid
Molecular Mass : 40.7 kDa
AA Sequence : MKVTGITILFWPLSMILLSDKIQSSKREVQCNFTEKNYTLIPADIKKDVTILDLSYNQITLNGTDTRVLQTYFLLTELYLIENKVTILHNNGFGNLSSLEILNICRNSIYVIQQGAFLGLNKLKQLYLCQNKIEQLNADVFVPLRSLKLLNLQGNLISYLDVPPLFHLELITLYGNLWNCSCSLFNLQNWLNTSNVTLENENITMCSYPNSLQSYNIKTVPHKAECHSKFPSSVTEDLYIHFQPISNSIFNSSSNNLTRNSEHEPLGKSWAFLVGVVVTVLTTSLLIFIAIKCPIWYNILLSYNHHRLEEHEAETYEDGFTGNPSSLSQIPETNSEETTVIFEQLHSFVVDDDGFIEDKYIDIHELCEEN
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name LRRC19 leucine rich repeat containing 19 [ Homo sapiens ]
Official Symbol LRRC19
Synonyms LRRC19; leucine rich repeat containing 19; leucine-rich repeat-containing protein 19; FLJ21302;
Gene ID 64922
mRNA Refseq NM_022901
Protein Refseq NP_075052
UniProt ID Q9H756

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC19 Products

Required fields are marked with *

My Review for All LRRC19 Products

Required fields are marked with *

0
cart-icon
0
compare icon