Recombinant Human LRRC19 Protein
Cat.No. : | LRRC19-4681H |
Product Overview : | Human LRRC19 full-length ORF (ADR82971.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | LRRC19 (Leucine Rich Repeat Containing 19) is a Protein Coding gene. |
Form : | Liquid |
Molecular Mass : | 40.7 kDa |
AA Sequence : | MKVTGITILFWPLSMILLSDKIQSSKREVQCNFTEKNYTLIPADIKKDVTILDLSYNQITLNGTDTRVLQTYFLLTELYLIENKVTILHNNGFGNLSSLEILNICRNSIYVIQQGAFLGLNKLKQLYLCQNKIEQLNADVFVPLRSLKLLNLQGNLISYLDVPPLFHLELITLYGNLWNCSCSLFNLQNWLNTSNVTLENENITMCSYPNSLQSYNIKTVPHKAECHSKFPSSVTEDLYIHFQPISNSIFNSSSNNLTRNSEHEPLGKSWAFLVGVVVTVLTTSLLIFIAIKCPIWYNILLSYNHHRLEEHEAETYEDGFTGNPSSLSQIPETNSEETTVIFEQLHSFVVDDDGFIEDKYIDIHELCEEN |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | LRRC19 leucine rich repeat containing 19 [ Homo sapiens ] |
Official Symbol | LRRC19 |
Synonyms | LRRC19; leucine rich repeat containing 19; leucine-rich repeat-containing protein 19; FLJ21302; |
Gene ID | 64922 |
mRNA Refseq | NM_022901 |
Protein Refseq | NP_075052 |
UniProt ID | Q9H756 |
◆ Recombinant Proteins | ||
LRRC19-4681H | Recombinant Human LRRC19 Protein | +Inquiry |
LRRC19-5100H | Recombinant Human LRRC19 Protein (Ser25-Trp270), C-His tagged | +Inquiry |
LRRC19-5175M | Recombinant Mouse LRRC19 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRC19-9254M | Recombinant Mouse LRRC19 Protein | +Inquiry |
LRRC19-5947HF | Recombinant Full Length Human LRRC19 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC19 Products
Required fields are marked with *
My Review for All LRRC19 Products
Required fields are marked with *