Recombinant Full Length Human LRRC29 Protein, GST-tagged
Cat.No. : | LRRC29-5955HF |
Product Overview : | Human LRRC29 full-length ORF ( NP_001004055.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 223 amino acids |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 9 tandem leucine-rich repeats. Two transcript variants encoding the same protein have been found for this gene. Other variants may occur, but their full-length natures have not been characterized. [provided by RefSeq |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRC29 leucine rich repeat containing 29 [ Homo sapiens ] |
Official Symbol | LRRC29 |
Synonyms | LRRC29; leucine rich repeat containing 29; F box and leucine rich repeat protein 9 , FBXL9; leucine-rich repeat-containing protein 29; FBL9; F-box protein FBL9; F-box/LRR-repeat protein 9; F-box and leucine-rich repeat protein 9; FBXL9; |
Gene ID | 26231 |
mRNA Refseq | NM_001004055 |
Protein Refseq | NP_001004055 |
UniProt ID | Q8WV35 |
◆ Recombinant Proteins | ||
LRRC29-5955HF | Recombinant Full Length Human LRRC29 Protein, GST-tagged | +Inquiry |
LRRC29-4674H | Recombinant Human LRRC29 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC29-4638HCL | Recombinant Human LRRC29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC29 Products
Required fields are marked with *
My Review for All LRRC29 Products
Required fields are marked with *
0
Inquiry Basket