Recombinant Human LRRC29 Protein, GST-tagged

Cat.No. : LRRC29-4674H
Product Overview : Human LRRC29 full-length ORF ( NP_001004055.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 9 tandem leucine-rich repeats. Two transcript variants encoding the same protein have been found for this gene. Other variants may occur, but their full-length natures have not been characterized. [provided by RefSeq
Molecular Mass : 50.2 kDa
AA Sequence : MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRC29 leucine rich repeat containing 29 [ Homo sapiens ]
Official Symbol LRRC29
Synonyms LRRC29; leucine rich repeat containing 29; F box and leucine rich repeat protein 9 , FBXL9; leucine-rich repeat-containing protein 29; FBL9; F-box protein FBL9; F-box/LRR-repeat protein 9; F-box and leucine-rich repeat protein 9; FBXL9;
Gene ID 26231
mRNA Refseq NM_001004055
Protein Refseq NP_001004055
UniProt ID Q8WV35

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC29 Products

Required fields are marked with *

My Review for All LRRC29 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon