Recombinant Full Length Human LRRIQ1 Protein, GST-tagged

Cat.No. : LRRIQ1-6076HF
Product Overview : Human LRRIQ1 full-length ORF ( AAH05399.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 240 amino acids
Description : LRRIQ1 (Leucine Rich Repeats And IQ Motif Containing 1) is a Protein Coding gene.
Molecular Mass : 54.4 kDa
AA Sequence : MDDDDAKLKAEIEAELDKLSISSLEKEDIESDAKSETQSDDSDTDSVELPESVLHCINIIKNRSKAVEELILQDLEDILSCSYGAVSNNHMHLRTGLSTEYEESSEQLIKILSEIEKEEFMRSKTDCATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKRHCWMKQFKVEKKKLENIQKVFCFCFSCIFKISSYL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRIQ1 leucine-rich repeats and IQ motif containing 1 [ Homo sapiens ]
Official Symbol LRRIQ1
Synonyms LRRIQ1; leucine-rich repeats and IQ motif containing 1;
Gene ID 84125
mRNA Refseq NM_001079910
Protein Refseq NP_001073379
UniProt ID Q96JM4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRIQ1 Products

Required fields are marked with *

My Review for All LRRIQ1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon