Recombinant Full Length Human LSAMP Protein
Cat.No. : | LSAMP-288HF |
Product Overview : | Recombinant full length protein of Human LSAMP with a N terminal proprietary tag; Predicted MWt 59.62kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 59.620kDa inclusive of tags |
Protein Length : | 310 amino acids |
AA Sequence : | VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRS GIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGS YTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSN VTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGIT REQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNE ATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKS TEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRP GSVRGINGSISLAVPLWLLAASLLCLLSKC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | LSAMP limbic system-associated membrane protein [ Homo sapiens ] |
Official Symbol : | LSAMP |
Synonyms : | LSAMP; limbic system-associated membrane protein; IgLON family member 3; IGLON3; LAMP |
Gene ID : | 4045 |
mRNA Refseq : | NM_002338 |
Protein Refseq : | NP_002329 |
MIM : | 603241 |
UniProt ID : | Q13449 |
Products Types
◆ Recombinant Protein | ||
LSAMP-4620H | Recombinant Human LSAMP Protein, GST-tagged | +Inquiry |
Lsamp-3850M | Recombinant Mouse Lsamp Protein, Myc/DDK-tagged | +Inquiry |
LSAMP-5222M | Recombinant Mouse LSAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
LSAMP-972H | Recombinant Human LSAMP Protein, MYC/DDK-tagged | +Inquiry |
LSAMP-3149R | Recombinant Rat LSAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
LSAMP-1755HCL | Recombinant Human LSAMP cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket