Recombinant Full Length Human LSAMP Protein
Cat.No. : | LSAMP-288HF |
Product Overview : | Recombinant full length protein of Human LSAMP with a N terminal proprietary tag; Predicted MWt 59.62kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 310 amino acids |
Description : | The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections. |
Form : | Liquid |
Molecular Mass : | 59.620kDa inclusive of tags |
AA Sequence : | VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRS GIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGS YTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSN VTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGIT REQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNE ATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKS TEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRP GSVRGINGSISLAVPLWLLAASLLCLLSKC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | LSAMP limbic system-associated membrane protein [ Homo sapiens ] |
Official Symbol | LSAMP |
Synonyms | LSAMP; limbic system-associated membrane protein; IgLON family member 3; IGLON3; LAMP |
Gene ID | 4045 |
mRNA Refseq | NM_002338 |
Protein Refseq | NP_002329 |
MIM | 603241 |
UniProt ID | Q13449 |
◆ Recombinant Proteins | ||
LSAMP-288HF | Recombinant Full Length Human LSAMP Protein | +Inquiry |
LSAMP-3992H | Recombinant Human LSAMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Lsamp-3850M | Recombinant Mouse Lsamp Protein, Myc/DDK-tagged | +Inquiry |
LSAMP-3493R | Recombinant Rat LSAMP Protein | +Inquiry |
LSAMP-3671Z | Recombinant Zebrafish LSAMP | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSAMP-1755HCL | Recombinant Human LSAMP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LSAMP Products
Required fields are marked with *
My Review for All LSAMP Products
Required fields are marked with *
0
Inquiry Basket