Recombinant Full Length Human LSM4 Protein, GST-tagged
| Cat.No. : | LSM4-5997HF |
| Product Overview : | Human LSM4 full-length ORF ( NP_036453.1, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 139 amino acids |
| Description : | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM |
| Molecular Mass : | 41.7 kDa |
| AA Sequence : | MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LSM4 LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | LSM4 |
| Synonyms | LSM4; LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm4; YER112W; glycine-rich protein; GRP; |
| Gene ID | 25804 |
| mRNA Refseq | NM_001252129 |
| Protein Refseq | NP_001239058 |
| MIM | 607284 |
| UniProt ID | Q9Y4Z0 |
| ◆ Recombinant Proteins | ||
| LSM4-4608H | Recombinant Human LSM4 Protein, GST-tagged | +Inquiry |
| LSM4-3007H | Recombinant Human LSM4 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae), T7-tagged | +Inquiry |
| LSM4-2584R | Recombinant Rhesus monkey LSM4 Protein, His-tagged | +Inquiry |
| LSM4-1867H | Recombinant Human LSM4 protein, GST-tagged | +Inquiry |
| LSM4-3185H | Recombinant Human LSM4 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LSM4-9173HCL | Recombinant Human LSM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSM4 Products
Required fields are marked with *
My Review for All LSM4 Products
Required fields are marked with *




