Recombinant Full Length Human LVRN Protein, GST-tagged
| Cat.No. : | LVRN-4943HF |
| Product Overview : | Human FLJ90650 full-length ORF ( AAH45809.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 198 amino acids |
| Description : | LVRN (Laeverin) is a Protein Coding gene. Diseases associated with LVRN include Chronic Laryngitis. GO annotations related to this gene include metallopeptidase activity. An important paralog of this gene is ANPEP. |
| Molecular Mass : | 49.6 kDa |
| AA Sequence : | MKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKNRTLLTSNDTWIVPILWIKNGTTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKMR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LVRN laeverin [ Homo sapiens (human) ] |
| Official Symbol | LVRN |
| Synonyms | LVRN; laeverin; APQ; AQPEP; TAQPEP; aminopeptidase Q; AP-Q; CHL2 antigen |
| Gene ID | 206338 |
| mRNA Refseq | NM_173800 |
| Protein Refseq | NP_776161 |
| MIM | 610046 |
| UniProt ID | Q6Q4G3 |
| ◆ Recombinant Proteins | ||
| LVRN-1413H | Recombinant Human LVRN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LVRN-4357H | Recombinant Human LVRN Protein, GST-tagged | +Inquiry |
| Lvrn-3868M | Recombinant Mouse Lvrn Protein, Myc/DDK-tagged | +Inquiry |
| LVRN-1214H | Recombinant Human LVRN Protein, MYC/DDK-tagged | +Inquiry |
| LVRN-4943HF | Recombinant Full Length Human LVRN Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LVRN Products
Required fields are marked with *
My Review for All LVRN Products
Required fields are marked with *
