Recombinant Human LVRN Protein, GST-tagged

Cat.No. : LVRN-4357H
Product Overview : Human FLJ90650 full-length ORF ( AAH45809.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LVRN (Laeverin) is a Protein Coding gene. Diseases associated with LVRN include Chronic Laryngitis. GO annotations related to this gene include metallopeptidase activity. An important paralog of this gene is ANPEP.
Molecular Mass : 49.6 kDa
AA Sequence : MKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKNRTLLTSNDTWIVPILWIKNGTTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKMR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LVRN laeverin [ Homo sapiens (human) ]
Official Symbol LVRN
Synonyms LVRN; laeverin; APQ; AQPEP; TAQPEP; aminopeptidase Q; AP-Q; CHL2 antigen
Gene ID 206338
mRNA Refseq NM_173800
Protein Refseq NP_776161
MIM 610046
UniProt ID Q6Q4G3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LVRN Products

Required fields are marked with *

My Review for All LVRN Products

Required fields are marked with *

0
cart-icon