Recombinant Full Length Human LY6G6F Protein, C-Flag-tagged
Cat.No. : | LY6G6F-1304HFL |
Product Overview : | Recombinant Full Length Human LY6G6F Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The human G6f protein is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 30.7 kDa |
AA Sequence : | MAVLFLLLFLCGTPQAADNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRP APDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSP CNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGV SFSLAASIDASPALCAPSTGWDMPWILMLLLTMGQGVVILALSIVLWRQRVRGAPGRDASIPQFKPEIQV YENIHLARLGPPAHKPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | LY6G6F lymphocyte antigen 6 family member G6F [ Homo sapiens (human) ] |
Official Symbol | LY6G6F |
Synonyms | G6f; NG32; LY6G6; LY6G6D; C6orf21 |
Gene ID | 259215 |
mRNA Refseq | NM_001003693.3 |
Protein Refseq | NP_001003693.1 |
MIM | 611404 |
UniProt ID | Q5SQ64 |
◆ Recombinant Proteins | ||
LY6G6F-1329H | Recombinant Human LY6G6F Protein, His (Fc)-Avi-tagged | +Inquiry |
LY6G6F-1215H | Recombinant Human LY6G6F Protein, MYC/DDK-tagged | +Inquiry |
LY6G6F-15900H | Recombinant Human LY6G6F, His-tagged | +Inquiry |
Ly6g6f-3870M | Recombinant Mouse Ly6g6f Protein, Myc/DDK-tagged | +Inquiry |
LY6G6F-3686H | Recombinant Human LY6G6F Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6G6F Products
Required fields are marked with *
My Review for All LY6G6F Products
Required fields are marked with *
0
Inquiry Basket