Recombinant Full Length Human LYG1 Protein, GST-tagged

Cat.No. : LYG1-6233HF
Product Overview : Human LYG1 full-length ORF ( NP_777558.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 194 amino acids
Description : LYG1 (Lysozyme G1) is a Protein Coding gene. GO annotations related to this gene include lysozyme activity. An important paralog of this gene is LYG2.
Molecular Mass : 47.8 kDa
AA Sequence : MSALWLLLGLLALMDLSESSNWGCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYG1 lysozyme G-like 1 [ Homo sapiens ]
Official Symbol LYG1
Synonyms LYG1; lysozyme G-like 1; lysozyme g-like protein 1; SALW1939;
Gene ID 129530
mRNA Refseq NM_174898
Protein Refseq NP_777558
UniProt ID Q8N1E2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYG1 Products

Required fields are marked with *

My Review for All LYG1 Products

Required fields are marked with *

0
cart-icon