Recombinant Full Length Human LYL1 Protein, GST-tagged
Cat.No. : | LYL1-6236HF |
Product Overview : | Human LYL1 full-length ORF (AAH02796.2, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 280 amino acids |
Description : | This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia. [provided by RefSeq, Sep 2010] |
Molecular Mass : | 57.2 kDa |
AA Sequence : | MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYL1 lymphoblastic leukemia derived sequence 1 [ Homo sapiens ] |
Official Symbol | LYL1 |
Synonyms | LYL1; lymphoblastic leukemia derived sequence 1; protein lyl-1; bHLHa18; class A basic helix-loop-helix protein 18; |
Gene ID | 4066 |
mRNA Refseq | NM_005583 |
Protein Refseq | NP_005574 |
MIM | 151440 |
UniProt ID | P12980 |
◆ Recombinant Proteins | ||
LYL1-3411H | Recombinant Human LYL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYL1-5262M | Recombinant Mouse LYL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYL1-6236HF | Recombinant Full Length Human LYL1 Protein, GST-tagged | +Inquiry |
LYL1-265H | Recombinant Human LYL1 | +Inquiry |
LYL1-4558H | Recombinant Human LYL1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYL1-1042HCL | Recombinant Human LYL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYL1 Products
Required fields are marked with *
My Review for All LYL1 Products
Required fields are marked with *
0
Inquiry Basket