Recombinant Full Length Human Lymphocyte Function-Associated Antigen 3(Cd58) Protein, His-Tagged
Cat.No. : | RFL27474HF |
Product Overview : | Recombinant Full Length Human Lymphocyte function-associated antigen 3(CD58) Protein (P19256) (29-250aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (29-250) |
Form : | Lyophilized powder |
AA Sequence : | FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD58 |
Synonyms | CD58; LFA3; Lymphocyte function-associated antigen 3; Ag3; Surface glycoprotein LFA-3; CD antigen CD58 |
UniProt ID | P19256 |
◆ Recombinant Proteins | ||
CD58-005H | Recombinant Human CD58 Protein, DDK/His-tagged | +Inquiry |
CD58-166H | Recombinant Human CD58 Protein, Fc-tagged | +Inquiry |
CD58-1240H | Recombinant Human CD58 Protein (Met1-Arg215), C-His tagged | +Inquiry |
CD58-3005HF | Recombinant Full Length Human CD58 Protein, GST-tagged | +Inquiry |
CD58-1443H | Recombinant Human CD58 Protein (Phe29-His214), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD58-797CCL | Recombinant Cynomolgus CD58 cell lysate | +Inquiry |
CD58-1127HCL | Recombinant Human CD58 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD58 Products
Required fields are marked with *
My Review for All CD58 Products
Required fields are marked with *
0
Inquiry Basket