Recombinant Full Length Human LYNX1-SLURP2 Protein, C-Flag-tagged
| Cat.No. : | LYNX1-SLURP2-964HFL |
| Product Overview : | Recombinant Full Length Human LYNX1-SLURP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This locus represents naturally occurring read-through transcription between the neighboring LYNX1 and SLURP2 genes. The readthrough transcript encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The significance of this read-through transcription and the function of the resulting protein product have not yet been determined. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 13.8 kDa |
| AA Sequence : | MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSH GSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | LYNX1-SLURP2 LYNX1-SLURP2 readthrough [ Homo sapiens (human) ] |
| Official Symbol | LYNX1-SLURP2 |
| Synonyms | SLURP2 |
| Gene ID | 111188157 |
| mRNA Refseq | NM_023946.5 |
| Protein Refseq | NP_076435.1 |
| UniProt ID | P0DP58 |
| ◆ Recombinant Proteins | ||
| LYNX1-SLURP2-1332H | Recombinant Human LYNX1-SLURP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LYNX1-SLURP2-964HFL | Recombinant Full Length Human LYNX1-SLURP2 Protein, C-Flag-tagged | +Inquiry |
| LYNX1-SLURP2-2807H | Recombinant Human LYNX1-SLURP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYNX1-SLURP2 Products
Required fields are marked with *
My Review for All LYNX1-SLURP2 Products
Required fields are marked with *
