Recombinant Human LYNX1-SLURP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LYNX1-SLURP2-2807H
• Product Overview: LYNX1 MS Standard C13 and N15-labeled recombinant protein (NP_076435) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This locus represents naturally occurring read-through transcription between the neighboring LYNX1 and SLURP2 genes. The readthrough transcript encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The significance of this read-through transcription and the function of the resulting protein product have not yet been determined.
• Molecular Mass: 13.8 kDa
• AA Sequence: MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LYNX1-SLURP2 LYNX1-SLURP2 readthrough [ Homo sapiens (human) ]
• Official Symbol: LYNX1-SLURP2
• Synonyms: LYNX1-SLURP2; LYNX1-SLURP2 readthrough; LYNX1-SLURP2 protein
• Gene ID: 111188157
• mRNA Refseq: NM_023946
• Protein Refseq: NP_076435
• UniProt ID: P0DP58