Recombinant Full Length Human LYPD4 Protein, GST-tagged

Cat.No. : LYPD4-6239HF
Product Overview : Human LYPD4 full-length ORF ( AAH34629.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 211 amino acids
Description : LYPD4 (LY6/PLAUR Domain Containing 4) is a Protein Coding gene. Diseases associated with LYPD4 include Mitral Valve Insufficiency and Retinitis Pigmentosa 4, Autosomal Dominant Or Recessive. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. An important paralog of this gene is CD177.
Molecular Mass : 49 kDa
AA Sequence : MGPQHLRLVQLFCLLGAISTLPRMSCGAGCYKTQKGTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASCSCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKVTEVLNILEKSQIVGAASSRQDPAWGVVLGLLFAFRD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYPD4 LY6/PLAUR domain containing 4 [ Homo sapiens ]
Official Symbol LYPD4
Synonyms LYPD4; LY6/PLAUR domain containing 4; ly6/PLAUR domain-containing protein 4; MGC42718; sperm membrane receptor; SMR;
Gene ID 147719
mRNA Refseq NM_173506
Protein Refseq NP_775777
UniProt ID Q6UWN0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYPD4 Products

Required fields are marked with *

My Review for All LYPD4 Products

Required fields are marked with *

0
cart-icon
0
compare icon