Recombinant Full Length Human LYPD4 Protein, GST-tagged
Cat.No. : | LYPD4-6239HF |
Product Overview : | Human LYPD4 full-length ORF ( AAH34629.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 211 amino acids |
Description : | LYPD4 (LY6/PLAUR Domain Containing 4) is a Protein Coding gene. Diseases associated with LYPD4 include Mitral Valve Insufficiency and Retinitis Pigmentosa 4, Autosomal Dominant Or Recessive. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. An important paralog of this gene is CD177. |
Molecular Mass : | 49 kDa |
AA Sequence : | MGPQHLRLVQLFCLLGAISTLPRMSCGAGCYKTQKGTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASCSCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKVTEVLNILEKSQIVGAASSRQDPAWGVVLGLLFAFRD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYPD4 LY6/PLAUR domain containing 4 [ Homo sapiens ] |
Official Symbol | LYPD4 |
Synonyms | LYPD4; LY6/PLAUR domain containing 4; ly6/PLAUR domain-containing protein 4; MGC42718; sperm membrane receptor; SMR; |
Gene ID | 147719 |
mRNA Refseq | NM_173506 |
Protein Refseq | NP_775777 |
UniProt ID | Q6UWN0 |
◆ Recombinant Proteins | ||
LYPD4-4553H | Recombinant Human LYPD4 Protein, GST-tagged | +Inquiry |
LYPD4-6239HF | Recombinant Full Length Human LYPD4 Protein, GST-tagged | +Inquiry |
LYPD4-9391M | Recombinant Mouse LYPD4 Protein | +Inquiry |
LYPD4-5267M | Recombinant Mouse LYPD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPD4 Products
Required fields are marked with *
My Review for All LYPD4 Products
Required fields are marked with *