Recombinant Human LYPLA1 Protein, His-tagged
Cat.No. : | LYPLA1-308H |
Product Overview : | Recombinant Human LYPLA1 fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | THis gene encodes a member of the alpha/beta hydrolase superfamily. The encoded protein functions as a homodimer, exhibiting both depalmitoylating as well as lysophospholipase activity, and may be involved in Ras localization and signaling. Alternate splicing results in multiple transcript variants. Pseudogenes of tHis gene have been defined on chromosomes 4, 6, and 7. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0 |
Molecular Mass : | 26.8kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | LYPLA1 lysophospholipase I [ Homo sapiens ] |
Official Symbol | LYPLA1 |
Synonyms | LYPLA1; lysophospholipase I; acyl-protein thioesterase 1; LPL1; LPL-I; lysoPLA I; lysophospholipase 1; acyl-protein thioesterase-1; lysophospholipid-specific lysophospholipase; APT-1; hAPT1; LYSOPLA; |
Gene ID | 10434 |
mRNA Refseq | NM_006330 |
Protein Refseq | NP_006321 |
MIM | 605599 |
UniProt ID | O75608 |
◆ Recombinant Proteins | ||
LYPLA1-5270M | Recombinant Mouse LYPLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPLA1-3173R | Recombinant Rat LYPLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPLA1-2387Z | Recombinant Zebrafish LYPLA1 | +Inquiry |
LYPLA1-9396M | Recombinant Mouse LYPLA1 Protein | +Inquiry |
LYPLA1-0171H | Recombinant Human LYPLA1 Protein (Met1-Asp230), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPLA1-4589HCL | Recombinant Human LYPLA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPLA1 Products
Required fields are marked with *
My Review for All LYPLA1 Products
Required fields are marked with *
0
Inquiry Basket