Recombinant Full Length Human LYRM7 Protein, GST-tagged

Cat.No. : LYRM7-6034HF
Product Overview : Human LYRM7 full-length ORF (1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 104 amino acids
Description : Inner mitochondrial membrane complex III (CIII) is the main enzyme complex in the mitochondrial respiratory chain, and Rieske Fe-S protein (UQCRFS1) is the last catalytic subunit added to the complex. The protein encoded by this gene is a nuclear-encoded mitochondrial matrix protein that stabilizes UQCRFS1 and chaperones it to the CIII complex. Defects in this gene are a cause of mitochondrial complex III deficiency, nuclear type 8. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]
Molecular Mass : 37.84 kDa
AA Sequence : MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYRM7 LYR motif containing 7 [ Homo sapiens (human) ]
Official Symbol LYRM7
Synonyms LYRM7; LYR motif containing 7; MZM1L; MC3DN8; C5orf31; complex III assembly factor LYRM7; LYR motif-containing protein 7; Lyrm7 homolog
Gene ID https://www.ncbi.nlm.nih.gov/gene/?term=90624
mRNA Refseq NM_001293735
Protein Refseq NP_001280664
MIM 615831
UniProt ID Q5U5X0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYRM7 Products

Required fields are marked with *

My Review for All LYRM7 Products

Required fields are marked with *

0
cart-icon
0
compare icon