Recombinant Full Length Human LYSMD2 Protein, GST-tagged
Cat.No. : | LYSMD2-6035HF |
Product Overview : | Human LYSMD2 full-length ORF ( NP_699205.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 215 amino acids |
Description : | LYSMD2 (LysM Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is LYSMD1. |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MADSSPALSLREGGPRAPRPSAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYATSLYHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYSMD2 LysM, putative peptidoglycan-binding, domain containing 2 [ Homo sapiens ] |
Official Symbol | LYSMD2 |
Synonyms | LYSMD2; LysM, putative peptidoglycan-binding, domain containing 2; lysM and putative peptidoglycan-binding domain-containing protein 2; MGC35274; DKFZp686I2243; |
Gene ID | 256586 |
mRNA Refseq | NM_001143917 |
Protein Refseq | NP_001137389 |
UniProt ID | Q8IV50 |
◆ Recombinant Proteins | ||
LYSMD2-948Z | Recombinant Zebrafish LYSMD2 | +Inquiry |
LYSMD2-4537H | Recombinant Human LYSMD2 Protein, GST-tagged | +Inquiry |
LYSMD2-5564C | Recombinant Chicken LYSMD2 | +Inquiry |
LYSMD2-668H | Recombinant Human LYSMD2, GST-tagged | +Inquiry |
LYSMD2-5565C | Recombinant Chicken LYSMD2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYSMD2-1043HCL | Recombinant Human LYSMD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYSMD2 Products
Required fields are marked with *
My Review for All LYSMD2 Products
Required fields are marked with *
0
Inquiry Basket