Recombinant Full Length Human LYSMD2 Protein, GST-tagged

• Cat.No.: LYSMD2-6035HF
• Product Overview: Human LYSMD2 full-length ORF ( NP_699205.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 215 amino acids
• Description: LYSMD2 (LysM Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is LYSMD1.
• Molecular Mass: 49.9 kDa
• AA Sequence: MADSSPALSLREGGPRAPRPSAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYATSLYHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYSMD2 LysM, putative peptidoglycan-binding, domain containing 2 [ Homo sapiens ]
• Official Symbol: LYSMD2
• Synonyms: LYSMD2; LysM, putative peptidoglycan-binding, domain containing 2; lysM and putative peptidoglycan-binding domain-containing protein 2; MGC35274; DKFZp686I2243
• Gene ID: 256586
• mRNA Refseq: NM_001143917
• Protein Refseq: NP_001137389
• UniProt ID: Q8IV50