Recombinant Full Length Human MAG Protein, C-Flag-tagged
Cat.No. : | MAG-1466HFL |
Product Overview : | Recombinant Full Length Human MAG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.1 kDa |
AA Sequence : | MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYP PVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVNT PNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTREA NGHRLGCQASFPNTTLQFEGYASMDVKYPPVIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGTVL REAVAESLLLELEEVTPAEDGVYACLAENAYGQDNRTVGLSVMYAPWKPTVNGTMVAVEGETVSILCSTQ SNPDPILTIFKEKQILSTVIYESELQLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPVLLLESH CAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNESEREFVYSERSGLVLTSILTLRGQAQAPPRVICTA RNLYGAKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKKNVTESPSFSAGDNPPVLFSS DFRISGAPEKYESERRLGSERRLLGLRGEPPELDLSYSHSDLGKRPTKDSYTLTEELAEYAEIRVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs) |
Full Length : | Full L. |
Gene Name | MAG myelin associated glycoprotein [ Homo sapiens (human) ] |
Official Symbol | MAG |
Synonyms | GMA; S-MAG; SPG75; SIGLEC4A; SIGLEC-4A |
Gene ID | 4099 |
mRNA Refseq | NM_002361.4 |
Protein Refseq | NP_002352.1 |
MIM | 159460 |
UniProt ID | P20916 |
◆ Recombinant Proteins | ||
Mag-1796R | Recombinant Rat Myelin-associated Glycoprotein | +Inquiry |
Mag-476M | Recombinant Mouse Mag Protein, Fc-tagged | +Inquiry |
MAG-4484H | Recombinant Human MAG Protein (Gly20-Pro516), C-His tagged | +Inquiry |
MAG-29106TH | Recombinant Human MAG | +Inquiry |
MAG-2063H | Recombinant Human MAG Protein, Fc/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAG-1315HCL | Recombinant Human MAG cell lysate | +Inquiry |
MAG-1681HCL | Recombinant Human MAG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAG Products
Required fields are marked with *
My Review for All MAG Products
Required fields are marked with *
0
Inquiry Basket