Recombinant Full Length Human MAL Protein, C-Flag-tagged
Cat.No. : | MAL-1627HFL |
Product Overview : | Recombinant Full Length Human MAL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 16.5 kDa |
AA Sequence : | MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLI ILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYV VHAVFSLIRWKSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | MAL mal, T cell differentiation protein [ Homo sapiens (human) ] |
Official Symbol | MAL |
Synonyms | MVP17; VIP17 |
Gene ID | 4118 |
mRNA Refseq | NM_002371.4 |
Protein Refseq | NP_002362.1 |
MIM | 188860 |
UniProt ID | P21145 |
◆ Recombinant Proteins | ||
MAL-3548R | Recombinant Rat MAL Protein | +Inquiry |
MAL-1348H | Recombinant Human MAL Protein, His (Fc)-Avi-tagged | +Inquiry |
MAL-3387H | Recombinant Human MAL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAL-5307M | Recombinant Mouse MAL Protein, His (Fc)-Avi-tagged | +Inquiry |
MAL-2445Z | Recombinant Zebrafish MAL | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAL-4530HCL | Recombinant Human MAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAL Products
Required fields are marked with *
My Review for All MAL Products
Required fields are marked with *
0
Inquiry Basket