Recombinant Human MAL Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MAL-2790H
Product Overview : MAL MS Standard C13 and N15-labeled recombinant protein (NP_071883) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3.
Molecular Mass : 11.9 kDa
AA Sequence : MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLVFSYIATLLYVVHAVFSLIRWKSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MAL mal, T cell differentiation protein [ Homo sapiens (human) ]
Official Symbol MAL
Synonyms MAL; mal, T-cell differentiation protein; myelin and lymphocyte protein; T-cell differentiation protein MAL; T-lymphocyte maturation-associated protein;
Gene ID 4118
mRNA Refseq NM_022438
Protein Refseq NP_071883
MIM 188860
UniProt ID P21145

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAL Products

Required fields are marked with *

My Review for All MAL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon