Recombinant Full Length Human MANBAL Protein, C-Flag-tagged

• Cat.No.: MANBAL-2004HFL
• Product Overview: Recombinant Full Length Human MANBAL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to be integral component of membrane.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 9.3 kDa
• AA Sequence: MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV PSVNKRPKKETKKKR myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: MANBAL mannosidase beta like [ Homo sapiens (human) ]
• Official Symbol: MANBAL
• Gene ID: 63905
• mRNA Refseq: NM_001003897.2
• Protein Refseq: NP_001003897.1
• UniProt ID: Q9NQG1