Recombinant Full Length Human MANBAL Protein, C-Flag-tagged
Cat.No. : | MANBAL-2004HFL |
Product Overview : | Recombinant Full Length Human MANBAL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be integral component of membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 9.3 kDa |
AA Sequence : | MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV PSVNKRPKKETKKKR myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | MANBAL mannosidase beta like [ Homo sapiens (human) ] |
Official Symbol | MANBAL |
Gene ID | 63905 |
mRNA Refseq | NM_001003897.2 |
Protein Refseq | NP_001003897.1 |
UniProt ID | Q9NQG1 |
◆ Recombinant Proteins | ||
RFL24666MF | Recombinant Full Length Mouse Protein Manbal(Manbal) Protein, His-Tagged | +Inquiry |
MANBAL-2657R | Recombinant Rhesus monkey MANBAL Protein, His-tagged | +Inquiry |
RFL9772HF | Recombinant Full Length Human Protein Manbal(Manbal) Protein, His-Tagged | +Inquiry |
MANBAL-2477R | Recombinant Rhesus Macaque MANBAL Protein, His (Fc)-Avi-tagged | +Inquiry |
MANBAL-1350H | Recombinant Human MANBAL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MANBAL-4521HCL | Recombinant Human MANBAL 293 Cell Lysate | +Inquiry |
MANBAL-4522HCL | Recombinant Human MANBAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MANBAL Products
Required fields are marked with *
My Review for All MANBAL Products
Required fields are marked with *
0
Inquiry Basket