Recombinant Full Length Human MED10 Protein, C-Flag-tagged
Cat.No. : | MED10-2042HFL |
Product Overview : | Recombinant Full Length Human MED10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | MED10 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 15.5 kDa |
AA Sequence : | MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEY IDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MED10 mediator complex subunit 10 [ Homo sapiens (human) ] |
Official Symbol | MED10 |
Synonyms | L6; NUT2; TRG20 |
Gene ID | 84246 |
mRNA Refseq | NM_032286.3 |
Protein Refseq | NP_115662.2 |
MIM | 612382 |
UniProt ID | Q9BTT4 |
◆ Recombinant Proteins | ||
MED10-429C | Recombinant Cynomolgus Monkey MED10 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED10-683C | Recombinant Cynomolgus MED10 Protein, His-tagged | +Inquiry |
MED10-3064H | Recombinant Human MED10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MED10-2042HFL | Recombinant Full Length Human MED10 Protein, C-Flag-tagged | +Inquiry |
MED10-2716R | Recombinant Rhesus monkey MED10 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED10-4393HCL | Recombinant Human MED10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED10 Products
Required fields are marked with *
My Review for All MED10 Products
Required fields are marked with *