Recombinant Full Length Human MED4 Protein, GST-tagged
| Cat.No. : | MED4-6250HF |
| Product Overview : | Human MED4 full-length ORF ( AAH05189, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 270 amino acids |
| Description : | This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
| Molecular Mass : | 55.44 kDa |
| AA Sequence : | MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MED4 mediator complex subunit 4 [ Homo sapiens ] |
| Official Symbol | MED4 |
| Synonyms | MED4; mediator complex subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae) , VDRIP, vitamin D receptor interacting protein; mediator of RNA polymerase II transcription subunit 4; DRIP36; HSPC126; TRAP36; TRAP/SMCC/PC2 subunit p36 subunit; activator-recruited cofactor 36 kDa component; mediator of RNA polymerase II transcription, subunit 4 homolog; vitamin D3 receptor-interacting protein complex 36 kDa component; ARC36; VDRIP; RP11-90M2.2; FLJ10956; |
| Gene ID | 29079 |
| mRNA Refseq | NM_014166 |
| Protein Refseq | NP_054885 |
| MIM | 605718 |
| UniProt ID | Q9NPJ6 |
| ◆ Recombinant Proteins | ||
| MED4-5201H | Recombinant Human MED4 protein, His-tagged | +Inquiry |
| MED4-3639R | Recombinant Rat MED4 Protein | +Inquiry |
| MED4-2727R | Recombinant Rhesus monkey MED4 Protein, His-tagged | +Inquiry |
| MED4-4467H | Recombinant Human MED4 Protein, GST-tagged | +Inquiry |
| MED4-2740H | Recombinant Human MED4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MED4-4381HCL | Recombinant Human MED4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED4 Products
Required fields are marked with *
My Review for All MED4 Products
Required fields are marked with *
