Recombinant Full Length Human MEF2A Protein, C-Flag-tagged
Cat.No. : | MEF2A-1842HFL |
Product Overview : | Recombinant Full Length Human MEF2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a DNA-binding transcription factor that activates many muscle-specific, growth factor-induced, and stress-induced genes. The encoded protein can act as a homodimer or as a heterodimer and is involved in several cellular processes, including muscle development, neuronal differentiation, cell growth control, and apoptosis. Defects in this gene could be a cause of autosomal dominant coronary artery disease 1 with myocardial infarction (ADCAD1). Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.7 kDa |
AA Sequence : | MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYT EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNF SMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLS TTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPS SKGMMPPLNTQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGM LSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQQQQQQQQQ QQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNTEDRESPSVK RMRMDAWVT SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | MEF2A myocyte enhancer factor 2A [ Homo sapiens (human) ] |
Official Symbol | MEF2A |
Synonyms | mef2; ADCAD1; RSRFC4; RSRFC9 |
Gene ID | 4205 |
mRNA Refseq | NM_005587.6 |
Protein Refseq | NP_005578.2 |
MIM | 600660 |
UniProt ID | Q02078 |
◆ Recombinant Proteins | ||
Mef2a-4024M | Recombinant Mouse Mef2a Protein, Myc/DDK-tagged | +Inquiry |
MEF2A-3640R | Recombinant Rat MEF2A Protein | +Inquiry |
MEF2A-6427C | Recombinant Chicken MEF2A | +Inquiry |
MEF2A-1842HFL | Recombinant Full Length Human MEF2A Protein, C-Flag-tagged | +Inquiry |
MEF2A-001H | Recombinant Human MEF2A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEF2A-4376HCL | Recombinant Human MEF2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEF2A Products
Required fields are marked with *
My Review for All MEF2A Products
Required fields are marked with *
0
Inquiry Basket