Recombinant Full Length Human MEIS2 Protein, GST-tagged

Cat.No. : MEIS2-6127HF
Product Overview : Human MEIS2 full-length ORF ( AAH01516, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 381 amino acids
Description : This gene encodes a homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq
Molecular Mass : 67.65 kDa
AA Sequence : MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MEIS2 Meis homeobox 2 [ Homo sapiens ]
Official Symbol MEIS2
Synonyms MEIS2; Meis homeobox 2; Meis (mouse) homolog 2 , Meis1, myeloid ecotropic viral integration site 1 homolog 2 (mouse); homeobox protein Meis2; HsT18361; MRG1; Meis homolog 2; Meis1-related gene 1; meis1-related protein 1; TALE homeobox protein Meis2; Meis1, myeloid ecotropic viral integration site 1 homolog 2; MGC2820;
Gene ID 4212
mRNA Refseq NM_001220482
Protein Refseq NP_001207411
MIM 601740
UniProt ID O14770

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MEIS2 Products

Required fields are marked with *

My Review for All MEIS2 Products

Required fields are marked with *

0
cart-icon