Recombinant Full Length Human MEIS2 Protein transcript variant a, C-Flag-tagged
Cat.No. : | MEIS2-20HFL |
Product Overview : | Recombinant Full Length Human MEIS2 Protein transcript variant a, fused to Flag-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Description : | This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 43.6 kDa |
AA Sequence : | MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage : | Store at -80 centigrade. |
Concentration : | >0.05 μg/μL as determined by microplate BCA method. |
Use/Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Gene Name | MEIS2 Meis homeobox 2 [ Homo sapiens (human) ] |
Official Symbol | MEIS2 |
Synonyms | MEIS2; Meis homeobox 2; CPCMR; HsT18361; MRG1 |
Gene ID | 4212 |
mRNA Refseq | NM_002399.4 |
Protein Refseq | NP_002390.1 |
MIM | 601740 |
UniProt ID | O14770 |
◆ Recombinant Proteins | ||
MEIS2-5471M | Recombinant Mouse MEIS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEIS2-6127HF | Recombinant Full Length Human MEIS2 Protein, GST-tagged | +Inquiry |
MEIS2-3257H | Recombinant Human MEIS2 Protein(79-270 aa), GST-tagged | +Inquiry |
MEIS2-4451H | Recombinant Human MEIS2 Protein, GST-tagged | +Inquiry |
MEIS2-6366C | Recombinant Chicken MEIS2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEIS2-4371HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
MEIS2-4370HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
MEIS2-4372HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEIS2 Products
Required fields are marked with *
My Review for All MEIS2 Products
Required fields are marked with *
0
Inquiry Basket