Recombinant Full Length Human METTL21C Protein, GST-tagged

• Cat.No.: METTL21C-1782HF
• Product Overview: Human C13orf39 full-length ORF ( NP_001010977.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 264 amino acids
• Description: Enables heat shock protein binding activity and protein-lysine N-methyltransferase activity. Involved in protein methylation. Located in nucleus. Part of protein-containing complex.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 56 kDa
• AA Sequence: MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWD
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL21C methyltransferase like 21C [ Homo sapiens ]
• Official Symbol: METTL21C
• Synonyms: METTL21C; methyltransferase like 21C; C13orf39, chromosome 13 open reading frame 39; methyltransferase-like protein 21C; LOC196541; C13orf39
• Gene ID: 196541
• mRNA Refseq: NM_001010977
• Protein Refseq: NP_001010977
• MIM: 615259
• UniProt ID: Q5VZV1