Recombinant Full Length Human METTL4 Protein, GST-tagged
| Cat.No. : | METTL4-6171HF |
| Product Overview : | Human METTL4 full-length ORF ( NP_073751.2, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 472 amino acids |
| Description : | METTL4 (Methyltransferase Like 4) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and methyltransferase activity. |
| Molecular Mass : | 80.5 kDa |
| AA Sequence : | MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | METTL4 methyltransferase like 4 [ Homo sapiens ] |
| Official Symbol | METTL4 |
| Synonyms | METTL4; methyltransferase like 4; methyltransferase-like protein 4; FLJ23017; HsT661; MGC117235; |
| Gene ID | 64863 |
| mRNA Refseq | NM_022840 |
| Protein Refseq | NP_073751 |
| MIM | 619626 |
| UniProt ID | Q8N3J2 |
| ◆ Recombinant Proteins | ||
| Mettl4-4049M | Recombinant Mouse Mettl4 Protein, Myc/DDK-tagged | +Inquiry |
| METTL4-4402H | Recombinant Human METTL4 Protein, GST-tagged | +Inquiry |
| METTL4-1193H | Recombinant Human METTL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| METTL4-837H | Recombinant Human METTL4, His-tagged | +Inquiry |
| METTL4-6171HF | Recombinant Full Length Human METTL4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| METTL4-4356HCL | Recombinant Human METTL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL4 Products
Required fields are marked with *
My Review for All METTL4 Products
Required fields are marked with *
