"METTL4" Related Products

Expand

Recombinant Human METTL4 Protein, GST-tagged

Cat.No. : METTL4-4402H
Product Overview : Human METTL4 full-length ORF ( NP_073751.2, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.
Description : METTL4 (Methyltransferase Like 4) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and methyltransferase activity.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 80.5 kDa
AA Sequence : MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue

Gene Name : METTL4 methyltransferase like 4 [ Homo sapiens ]
Official Symbol : METTL4
Synonyms : METTL4; methyltransferase like 4; methyltransferase-like protein 4; FLJ23017; HsT661; MGC117235;
Gene ID : 64863
mRNA Refseq : NM_022840
Protein Refseq : NP_073751
UniProt ID : Q8N3J2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.