Recombinant Human METTL4 Protein, GST-tagged
Cat.No. : | METTL4-4402H |
Product Overview : | Human METTL4 full-length ORF ( NP_073751.2, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | METTL4 (Methyltransferase Like 4) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and methyltransferase activity. |
Molecular Mass : | 80.5 kDa |
AA Sequence : | MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL4 methyltransferase like 4 [ Homo sapiens ] |
Official Symbol | METTL4 |
Synonyms | METTL4; methyltransferase like 4; methyltransferase-like protein 4; FLJ23017; HsT661; MGC117235; |
Gene ID | 64863 |
mRNA Refseq | NM_022840 |
Protein Refseq | NP_073751 |
UniProt ID | Q8N3J2 |
◆ Recombinant Proteins | ||
METTL4-1402H | Recombinant Human METTL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL4-5502M | Recombinant Mouse METTL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL4-9762M | Recombinant Mouse METTL4 Protein | +Inquiry |
METTL4-6322H | Recombinant Human METTL4 protein, His&Myc-tagged | +Inquiry |
METTL4-1193H | Recombinant Human METTL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL4-4356HCL | Recombinant Human METTL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All METTL4 Products
Required fields are marked with *
My Review for All METTL4 Products
Required fields are marked with *
0
Inquiry Basket