Recombinant Full Length Human METTL4 Protein, C-Flag-tagged
Cat.No. : | METTL4-977HFL |
Product Overview : | Recombinant Full Length Human METTL4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables RNA methyltransferase activity and site-specific DNA-methyltransferase (adenine-specific) activity. Involved in nucleic acid metabolic process; regulation of RNA metabolic process; and regulation of mitochondrial DNA replication. Located in cytosol; mitochondrial matrix; and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.9 kDa |
AA Sequence : | MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTK PENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVF NQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPS LNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKT FDVIVIDPPWQNKSVKRSNRYSYLSPLQIKQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEV VAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHK PPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | METTL4 methyltransferase 4, N6-adenosine [ Homo sapiens (human) ] |
Official Symbol | METTL4 |
Synonyms | HsT661 |
Gene ID | 64863 |
mRNA Refseq | NM_022840.5 |
Protein Refseq | NP_073751.3 |
MIM | 619626 |
UniProt ID | Q8N3J2 |
◆ Recombinant Proteins | ||
METTL4-1402H | Recombinant Human METTL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL4-9762M | Recombinant Mouse METTL4 Protein | +Inquiry |
METTL4-4402H | Recombinant Human METTL4 Protein, GST-tagged | +Inquiry |
METTL4-6322H | Recombinant Human METTL4 protein, His&Myc-tagged | +Inquiry |
METTL4-837H | Recombinant Human METTL4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL4-4356HCL | Recombinant Human METTL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL4 Products
Required fields are marked with *
My Review for All METTL4 Products
Required fields are marked with *
0
Inquiry Basket