Recombinant Full Length Human MFAP5 Protein, GST-tagged
Cat.No. : | MFAP5-6194HF |
Product Overview : | Human MFAP5 full-length ORF ( NP_003471.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 173 amino acids |
Description : | This gene encodes a 25-kD microfibril-associated glycoprotein which is rich in serine and threonine residues. It lacks a hydrophobic carboxyl terminus and proline-, glutamine-, and tyrosine-rich regions, which are characteristics of a related 31-kDa microfibril-associated glycoprotein (MFAP2). The close similarity between these two proteins is confined to a central region of 60 aa where precise alignment of 7 cysteine residues occurs. The structural differences suggest that this encoded protein has some functions that are distinct from those of MFAP2. [provided by RefSeq |
Molecular Mass : | 46 kDa |
AA Sequence : | MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MFAP5 microfibrillar associated protein 5 [ Homo sapiens ] |
Official Symbol | MFAP5 |
Synonyms | MFAP5; microfibrillar associated protein 5; microfibrillar-associated protein 5; MAGP2; MP25; MAGP-2; MFAP-5; microfibril-associated glycoprotein 2; microfibril-associated glycoprotein-2; |
Gene ID | 8076 |
mRNA Refseq | NM_003480 |
Protein Refseq | NP_003471 |
MIM | 601103 |
UniProt ID | Q13361 |
◆ Recombinant Proteins | ||
MFAP5-1405H | Recombinant Human MFAP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFAP5-4437H | Recombinant Human MFAP5 protein, His-SUMO-tagged | +Inquiry |
MFAP5-5512M | Recombinant Mouse MFAP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFAP5-290H | Recombinant Human MFAP5 Protein, His-tagged | +Inquiry |
MFAP5-1927H | Recombinant Human MFAP5 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP5-1395HCL | Recombinant Human MFAP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP5 Products
Required fields are marked with *
My Review for All MFAP5 Products
Required fields are marked with *