Recombinant Full Length Human MFAP5 Protein, GST-tagged
| Cat.No. : | MFAP5-6194HF |
| Product Overview : | Human MFAP5 full-length ORF ( NP_003471.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 173 amino acids |
| Description : | This gene encodes a 25-kD microfibril-associated glycoprotein which is rich in serine and threonine residues. It lacks a hydrophobic carboxyl terminus and proline-, glutamine-, and tyrosine-rich regions, which are characteristics of a related 31-kDa microfibril-associated glycoprotein (MFAP2). The close similarity between these two proteins is confined to a central region of 60 aa where precise alignment of 7 cysteine residues occurs. The structural differences suggest that this encoded protein has some functions that are distinct from those of MFAP2. [provided by RefSeq |
| Molecular Mass : | 46 kDa |
| AA Sequence : | MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MFAP5 microfibrillar associated protein 5 [ Homo sapiens ] |
| Official Symbol | MFAP5 |
| Synonyms | MFAP5; microfibrillar associated protein 5; microfibrillar-associated protein 5; MAGP2; MP25; MAGP-2; MFAP-5; microfibril-associated glycoprotein 2; microfibril-associated glycoprotein-2; |
| Gene ID | 8076 |
| mRNA Refseq | NM_003480 |
| Protein Refseq | NP_003471 |
| MIM | 601103 |
| UniProt ID | Q13361 |
| ◆ Recombinant Proteins | ||
| Mfap5-292R | Recombinant Rat Mfap5 Protein, His-tagged | +Inquiry |
| MFAP5-4437H | Recombinant Human MFAP5 protein, His-SUMO-tagged | +Inquiry |
| MFAP5-5192H | Recombinant Human MFAP5 Protein (Leu24-Cys162), His tagged | +Inquiry |
| MFAP5-6194HF | Recombinant Full Length Human MFAP5 Protein, GST-tagged | +Inquiry |
| MFAP5-1243H | Recombinant Human MFAP5 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MFAP5-1395HCL | Recombinant Human MFAP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP5 Products
Required fields are marked with *
My Review for All MFAP5 Products
Required fields are marked with *
