Recombinant Full Length Human MGLL Protein, C-Flag-tagged
Cat.No. : | MGLL-730HFL |
Product Overview : | Recombinant Full Length Human MGLL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.1 kDa |
AA Sequence : | METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAIL TAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLI CRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHV LHKELPEVTNSVFHEINMWVSQRTATAGTASPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Protein Pathways : | Glycerolipid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | MGLL monoglyceride lipase [ Homo sapiens (human) ] |
Official Symbol | MGLL |
Synonyms | MGL; HUK5; MAGL; HU-K5 |
Gene ID | 11343 |
mRNA Refseq | NM_007283.7 |
Protein Refseq | NP_009214.1 |
MIM | 609699 |
UniProt ID | Q99685 |
◆ Recombinant Proteins | ||
MGLL18930H | Recombinant Human MGLL (1-303) (K36A L169S L176S) Protein | +Inquiry |
MGLL-9816M | Recombinant Mouse MGLL Protein | +Inquiry |
MGLL-2215M | Recombinant Mouse MGLL Protein (1-303 aa), His-SUMO-tagged | +Inquiry |
MGLL-10628Z | Recombinant Zebrafish MGLL | +Inquiry |
Mgll-206R | Recombinant Rat Mgll, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGLL-4331HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGLL Products
Required fields are marked with *
My Review for All MGLL Products
Required fields are marked with *
0
Inquiry Basket