Recombinant Full Length Human MGMT Protein, GST-tagged
| Cat.No. : | MGMT-6517HF |
| Product Overview : | Human MGMT full-length ORF ( AAH00824, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 207 amino acids |
| Description : | Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma. [provided by RefSeq, Sep 2015] |
| Molecular Mass : | 48.4 kDa |
| AA Sequence : | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MGMT O-6-methylguanine-DNA methyltransferase [ Homo sapiens ] |
| Official Symbol | MGMT |
| Synonyms | MGMT; O-6-methylguanine-DNA methyltransferase; methylated-DNA--protein-cysteine methyltransferase; methylguanine-DNA methyltransferase; O-6-methylguanine-DNA-alkyltransferase; O6-methylguanine-DNA methyltransferase; 6-O-methylguanine-DNA methyltransferase; |
| Gene ID | 4255 |
| mRNA Refseq | NM_002412 |
| Protein Refseq | NP_002403 |
| MIM | 156569 |
| UniProt ID | P16455 |
| ◆ Recombinant Proteins | ||
| MGMT-1408H | Recombinant Human MGMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| MGMT-2585R | Recombinant Rhesus Macaque MGMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| MGMT-004H | Recombinant Human MGMT Protein, His-tagged | +Inquiry |
| Mgmt-4062M | Recombinant Mouse Mgmt Protein, Myc/DDK-tagged | +Inquiry |
| Mgmt-2125R | Recombinant Rat Mgmt protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MGMT-1109HCL | Recombinant Human MGMT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGMT Products
Required fields are marked with *
My Review for All MGMT Products
Required fields are marked with *
