Recombinant Full Length Human MID1IP1 Protein, GST-tagged
Cat.No. : | MID1IP1-6586HF |
Product Overview : | Human MID1IP1 full-length ORF ( NP_067065.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 183 amino acids |
Description : | MID1IP1 (MID1 Interacting Protein 1) is a Protein Coding gene. Among its related pathways are Metabolism and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). GO annotations related to this gene include protein C-terminus binding. An important paralog of this gene is THRSP. |
Molecular Mass : | 46.6 kDa |
AA Sequence : | MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MID1IP1 MID1 interacting protein 1 [ Homo sapiens (human) ] |
Official Symbol | MID1IP1 |
Synonyms | MID1IP1; S14R; MIG12; THRSPL; G12-like; STRAIT11499; MID1 interacting protein 1; mid1-interacting protein 1; spot 14-R; spot 14-related protein; MID1 interacting G12-like protein; gastrulation specific G12 homolog; mid1-interacting G12-like protein; gastrulation-specific G12-like protein; MID1 interacting protein 1 (gastrulation specific G12-like) |
Gene ID | 58526 |
mRNA Refseq | NM_001098790 |
Protein Refseq | NP_001092260 |
MIM | 300961 |
UniProt ID | Q9NPA3 |
◆ Recombinant Proteins | ||
MID1IP1-6586HF | Recombinant Full Length Human MID1IP1 Protein, GST-tagged | +Inquiry |
MID1IP1-458H | Recombinant Human MID1IP1 protein(Met1-His183), His-tagged | +Inquiry |
MID1IP1-1629H | Recombinant Human MID1IP1 | +Inquiry |
MID1IP1-5505H | Recombinant Human MID1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MID1IP1-2770R | Recombinant Rhesus monkey MID1IP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MID1IP1-4320HCL | Recombinant Human MID1IP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MID1IP1 Products
Required fields are marked with *
My Review for All MID1IP1 Products
Required fields are marked with *