Recombinant Human MID1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MID1IP1-5760H |
| Product Overview : | MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092261) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | MID1IP1 (MID1 Interacting Protein 1) is a Protein Coding gene. Diseases associated with MID1IP1 include Gluten Allergy and Scoliosis. Among its related pathways are Import of palmitoyl-CoA into the mitochondrial matrix and Metabolism. Gene Ontology (GO) annotations related to this gene include protein C-terminus binding. An important paralog of this gene is THRSP. |
| Molecular Mass : | 20.2 kDa |
| AA Sequence : | MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MID1IP1 MID1 interacting protein 1 [ Homo sapiens (human) ] |
| Official Symbol | MID1IP1 |
| Synonyms | MID1IP1; S14R; MIG12; THRSPL; G12-like; STRAIT11499; MID1 interacting protein 1; mid1-interacting protein 1; spot 14-R; spot 14-related protein; MID1 interacting G12-like protein; gastrulation specific G12 homolog; mid1-interacting G12-like protein; gastrulation-specific G12-like protein; MID1 interacting protein 1 (gastrulation specific G12-like) |
| Gene ID | 58526 |
| mRNA Refseq | NM_001098791 |
| Protein Refseq | NP_001092261 |
| MIM | 300961 |
| UniProt ID | Q9NPA3 |
| ◆ Recombinant Proteins | ||
| MID1IP1-3475H | Recombinant Human MID1IP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MID1IP1-4339H | Recombinant Human MID1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MID1IP1-6586HF | Recombinant Full Length Human MID1IP1 Protein, GST-tagged | +Inquiry |
| MID1IP1-2591R | Recombinant Rhesus Macaque MID1IP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MID1IP1-1629H | Recombinant Human MID1IP1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MID1IP1-4320HCL | Recombinant Human MID1IP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MID1IP1 Products
Required fields are marked with *
My Review for All MID1IP1 Products
Required fields are marked with *
