Recombinant Full Length Human MLANA Protein
Cat.No. : | MLANA-308HF |
Product Overview : | Recombinant full length Human MelanA with N terminal proprietary tag; Predicted MWt 39.09 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 118 amino acids |
Description : | MART-1 / Melan-A is a protein antigen found on melanocytes. Antibodies against the antigen are used in the medical specialty of anatomic pathology in order to recognize cells of melanocytic differentiation, useful for the diagnosis of a melanoma. |
Form : | Liquid |
Molecular Mass : | 39.090kDa inclusive of tags |
AA Sequence : | MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVL LLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFD HRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MLANA melan-A [ Homo sapiens ] |
Official Symbol | MLANA |
Synonyms | MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1 |
Gene ID | 2315 |
mRNA Refseq | NM_005511 |
Protein Refseq | NP_005502 |
MIM | 605513 |
UniProt ID | Q16655 |
◆ Recombinant Proteins | ||
MLANA-30193TH | Recombinant Human MLANA | +Inquiry |
MLANA-1282H | Recombinant Human MLANA Protein, His-B2M-tagged | +Inquiry |
MLANA-585H | Recombinant Human MLANA Protein, MYC/DDK-tagged | +Inquiry |
MLANA-308HF | Recombinant Full Length Human MLANA Protein | +Inquiry |
MLANA-6349HF | Recombinant Full Length Human MLANA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLANA-411HCL | Recombinant Human MLANA lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLANA Products
Required fields are marked with *
My Review for All MLANA Products
Required fields are marked with *