Recombinant Full Length Human MLANA Protein

• Cat.No.: MLANA-308HF
• Product Overview: Recombinant full length Human MelanA with N terminal proprietary tag; Predicted MWt 39.09 kDa.

Specification

• Description: MART-1 / Melan-A is a protein antigen found on melanocytes. Antibodies against the antigen are used in the medical specialty of anatomic pathology in order to recognize cells of melanocytic differentiation, useful for the diagnosis of a melanoma.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 39.090kDa inclusive of tags
• Protein Length: 118 amino acids
• AA Sequence: MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVL LLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFD HRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: MLANA melan-A [ Homo sapiens ]
• Official Symbol: MLANA
• Synonyms: MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1
• Gene ID: 2315
• mRNA Refseq: NM_005511
• Protein Refseq: NP_005502
• MIM: 605513
• UniProt ID: Q16655