Recombinant Full Length Human MLANA Protein

Cat.No. : MLANA-308HF
Product Overview : Recombinant full length Human MelanA with N terminal proprietary tag; Predicted MWt 39.09 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 118 amino acids
Description : MART-1 / Melan-A is a protein antigen found on melanocytes. Antibodies against the antigen are used in the medical specialty of anatomic pathology in order to recognize cells of melanocytic differentiation, useful for the diagnosis of a melanoma.
Form : Liquid
Molecular Mass : 39.090kDa inclusive of tags
AA Sequence : MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVL LLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFD HRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name MLANA melan-A [ Homo sapiens ]
Official Symbol MLANA
Synonyms MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1
Gene ID 2315
mRNA Refseq NM_005511
Protein Refseq NP_005502
MIM 605513
UniProt ID Q16655

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MLANA Products

Required fields are marked with *

My Review for All MLANA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon