Recombinant Human MLANA Protein, His-B2M-tagged
Cat.No. : | MLANA-1282H |
Product Overview : | Recombinant Human MLANA Protein (1-118aa) was expressed in E. coli with N-terminal His-B2M tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 1-118 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 27.2 kDa |
AA Sequence : | MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | MLANA melan-A [ Homo sapiens ] |
Official Symbol | MLANA |
Synonyms | MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1; antigen LB39-AA; antigen SK29-AA; protein Melan-A; MART-1 |
Gene ID | 2315 |
mRNA Refseq | NM_005511 |
Protein Refseq | NP_005502 |
MIM | 605513 |
UniProt ID | Q16655 |
◆ Recombinant Proteins | ||
MLANA-2043H | Recombinant Human Melan-A | +Inquiry |
MLANA-5379H | Recombinant Human MLANA Protein, GST-tagged | +Inquiry |
MLANA-7635H | Recombinant Human MLANA, His-tagged | +Inquiry |
MLANA-308HF | Recombinant Full Length Human MLANA Protein | +Inquiry |
MLANA-30193TH | Recombinant Human MLANA | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLANA-411HCL | Recombinant Human MLANA lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLANA Products
Required fields are marked with *
My Review for All MLANA Products
Required fields are marked with *