Recombinant Human MLANA Protein, His-B2M-tagged

• Cat.No.: MLANA-1282H
• Product Overview: Recombinant Human MLANA Protein (1-118aa) was expressed in E. coli with N-terminal His-B2M tag.

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Protein Length: 1-118 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 27.2 kDa
• AA Sequence: MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL
  TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: MLANA melan-A [ Homo sapiens ]
• Official Symbol: MLANA
• Synonyms: MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1; antigen LB39-AA; antigen SK29-AA; protein Melan-A; MART-1
• Gene ID: 2315
• mRNA Refseq: NM_005511
• Protein Refseq: NP_005502
• MIM: 605513
• UniProt ID: Q16655