Recombinant Human MLANA Protein, His-B2M-tagged
| Cat.No. : | MLANA-1282H |
| Product Overview : | Recombinant Human MLANA Protein (1-118aa) was expressed in E. coli with N-terminal His-B2M tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 1-118 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 27.2 kDa |
| AA Sequence : | MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | MLANA melan-A [ Homo sapiens ] |
| Official Symbol | MLANA |
| Synonyms | MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1; antigen LB39-AA; antigen SK29-AA; protein Melan-A; MART-1 |
| Gene ID | 2315 |
| mRNA Refseq | NM_005511 |
| Protein Refseq | NP_005502 |
| MIM | 605513 |
| UniProt ID | Q16655 |
| ◆ Recombinant Proteins | ||
| MLANA-7635H | Recombinant Human MLANA, His-tagged | +Inquiry |
| MLANA-30193TH | Recombinant Human MLANA | +Inquiry |
| MLANA-4686H | Recombinant Human MLANA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MLANA-2040H | Recombinant Human MLANA, GST-tagged | +Inquiry |
| MLANA-1417H | Recombinant Human MLANA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MLANA-411HCL | Recombinant Human MLANA lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLANA Products
Required fields are marked with *
My Review for All MLANA Products
Required fields are marked with *



