Recombinant Human MLANA Protein, His-B2M-tagged

Cat.No. : MLANA-1282H
Product Overview : Recombinant Human MLANA Protein (1-118aa) was expressed in E. coli with N-terminal His-B2M tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His
Protein Length : 1-118 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 27.2 kDa
AA Sequence : MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL
TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name MLANA melan-A [ Homo sapiens ]
Official Symbol MLANA
Synonyms MLANA; melan-A; melanoma antigen recognized by T-cells 1; MART1; antigen LB39-AA; antigen SK29-AA; protein Melan-A; MART-1
Gene ID 2315
mRNA Refseq NM_005511
Protein Refseq NP_005502
MIM 605513
UniProt ID Q16655

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MLANA Products

Required fields are marked with *

My Review for All MLANA Products

Required fields are marked with *

0
cart-icon