"Mlkl" Related Products

Expand

Recombinant Mouse Mlkl protein, His-tagged

Cat.No.: MLKL-9880M
Product Overview: Recombinant Mouse Mlkl(1-472aa) fused with His tag was expressed in HEK293.
Description: This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to lack protein kinase activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (Rip3), which is a key signaling molecule in necroptosis pathway. Knockout of this gene in mice showed that it is essential for necroptosis. Alternatively spliced transcript variants have been found for this gene.
Source: HEK293
Species: Mouse
Tag: His
Form: Tris-based buffer,50% glycerol
Molecular Mass: 56.3kD
Protein length: 1-472aa
AA Sequence: MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQI EKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKV ILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQ AESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVL RAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERSSSTIYVSPERLKNPFCL YDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGRS LSGRERILERLSAVEESTDKKV
Purity: >90% ( SDS-PAGE )
Storage: Store at -20 centigrade for extended storage conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name: Mlkl mixed lineage kinase domain-like [ Mus musculus ]
Official Symbol: Mlkl
Synonyms: MLKL; mixed lineage kinase domain-like; mixed lineage kinase domain-like protein; 9130019I15Rik;
Gene ID: 74568
mRNA Refseq: NM_029005
Protein Refseq: NP_083281
MIM:
UniProt ID: Q9D2Y4
Chromosome Location: 8; 8 D3
Function: ATP binding; protein kinase activity; transferase activity, transferring phosphorus-containing groups;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.