Recombinant Mouse Mlkl protein, His-tagged
Cat.No. : | MLKL-9880M |
Product Overview : | Recombinant Mouse Mlkl(1-472aa) fused with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-472aa |
Description : | This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to lack protein kinase activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (Rip3), which is a key signaling molecule in necroptosis pathway. Knockout of this gene in mice showed that it is essential for necroptosis. Alternatively spliced transcript variants have been found for this gene. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 56.3kD |
AA Sequence : | MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQI EKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKV ILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQ AESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVL RAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERSSSTIYVSPERLKNPFCL YDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGRS LSGRERILERLSAVEESTDKKV |
Purity : | >90% ( SDS-PAGE ) |
Storage : | Store at -20 centigrade for extended storage conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Gene Name | Mlkl mixed lineage kinase domain-like [ Mus musculus ] |
Official Symbol | Mlkl |
Synonyms | MLKL; mixed lineage kinase domain-like; mixed lineage kinase domain-like protein; 9130019I15Rik; |
Gene ID | 74568 |
mRNA Refseq | NM_029005 |
Protein Refseq | NP_083281 |
MIM | |
UniProt ID | Q9D2Y4 |
Chromosome Location | 8; 8 D3 |
Function | ATP binding; protein kinase activity; transferase activity, transferring phosphorus-containing groups; |
◆ Recombinant Proteins | ||
MLKL-95H | Recombinant Human MLKL, GST-tagged | +Inquiry |
MLKL-6980HF | Recombinant Full Length Human MLKL Protein, GST-tagged | +Inquiry |
MLKL-9880M | Recombinant Mouse Mlkl protein, His-tagged | +Inquiry |
MLKL-0925H | Recombinant Human MLKL Protein (E2-K471), Tag Free | +Inquiry |
MLKL-1098H | Recombinant Human MLKL Protein (1-471 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLKL-1115HCL | Recombinant Human MLKL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mlkl Products
Required fields are marked with *
My Review for All Mlkl Products
Required fields are marked with *
0
Inquiry Basket