Recombinant Mouse Mlkl protein, His-tagged

• Cat.No.: MLKL-9880M
• Product Overview: Recombinant Mouse Mlkl(1-472aa) fused with His tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 1-472aa
• Description: This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to lack protein kinase activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (Rip3), which is a key signaling molecule in necroptosis pathway. Knockout of this gene in mice showed that it is essential for necroptosis. Alternatively spliced transcript variants have been found for this gene.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 56.3kD
• AA Sequence: MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQI EKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKV ILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQ AESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVL RAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERSSSTIYVSPERLKNPFCL YDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGRS LSGRERILERLSAVEESTDKKV
• Purity: >90% ( SDS-PAGE )
• Storage: Store at -20 centigrade for extended storage conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.

Gene Information

• Gene Name: Mlkl mixed lineage kinase domain-like [ Mus musculus ]
• Official Symbol: Mlkl
• Synonyms: MLKL; mixed lineage kinase domain-like; mixed lineage kinase domain-like protein; 9130019I15Rik
• Gene ID: 74568
• mRNA Refseq: NM_029005
• Protein Refseq: NP_083281
• UniProt ID: Q9D2Y4
• Chromosome Location: 8; 8 D3
• Function: ATP binding; protein kinase activity; transferase activity, transferring phosphorus-containing groups