Recombinant Full Length Human MLLT6 Protein, GST-tagged
Cat.No. : | MLLT6-6366HF |
Product Overview : | Human MLLT6 full-length ORF ( AAH07237, 1 a.a. - 462 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 462 amino acids |
Description : | MLLT6 (MLLT6, PHD Finger Containing) is a Protein Coding gene. Diseases associated with MLLT6 include Myeloid/Lymphoid Or Mixed Lineage Leukemia and Leukemia, Acute Myeloid. An important paralog of this gene is MLLT10. |
Molecular Mass : | 76.56 kDa |
AA Sequence : | MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGGTADKGASANQEKG |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MLLT6 myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6 [ Homo sapiens ] |
Official Symbol | MLLT6 |
Synonyms | MLLT6; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6; myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 6; protein AF-17; AF17; FLJ23480; Myeloid/lymphoid or mixed lineage leukemia; translocated to; 6; trithorax homolog; ALL1-fused gene from chromosome 17 protein; Myeloid/lymphoid or mixed-lineage leukemia, translocated to, 6; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 6; |
Gene ID | 4302 |
mRNA Refseq | NM_005937 |
Protein Refseq | NP_005928 |
MIM | 600328 |
UniProt ID | P55198 |
◆ Recombinant Proteins | ||
MLLT6-2605R | Recombinant Rhesus Macaque MLLT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
MLLT6-6366HF | Recombinant Full Length Human MLLT6 Protein, GST-tagged | +Inquiry |
MLLT6-2784R | Recombinant Rhesus monkey MLLT6 Protein, His-tagged | +Inquiry |
MLLT6-307HF | Recombinant Full Length Human MLLT6 Protein | +Inquiry |
MLLT6-5393H | Recombinant Human MLLT6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLLT6-1118HCL | Recombinant Human MLLT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLLT6 Products
Required fields are marked with *
My Review for All MLLT6 Products
Required fields are marked with *