Recombinant Human MLLT6 Protein, GST-tagged

Cat.No. : MLLT6-5393H
Product Overview : Human MLLT6 full-length ORF ( AAH07237, 1 a.a. - 462 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MLLT6 (MLLT6, PHD Finger Containing) is a Protein Coding gene. Diseases associated with MLLT6 include Myeloid/Lymphoid Or Mixed Lineage Leukemia and Leukemia, Acute Myeloid. An important paralog of this gene is MLLT10.
Molecular Mass : 76.56 kDa
AA Sequence : MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGGTADKGASANQEKG
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MLLT6 myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6 [ Homo sapiens ]
Official Symbol MLLT6
Synonyms MLLT6; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6; myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 6; protein AF-17; AF17; FLJ23480; Myeloid/lymphoid or mixed lineage leukemia; translocated to; 6; trithorax homolog; ALL1-fused gene from chromosome 17 protein; Myeloid/lymphoid or mixed-lineage leukemia, translocated to, 6; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 6;
Gene ID 4302
mRNA Refseq NM_005937
Protein Refseq NP_005928
MIM 600328
UniProt ID P55198

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MLLT6 Products

Required fields are marked with *

My Review for All MLLT6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon