Recombinant Full Length Human MMD2 Protein, GST-tagged

• Cat.No.: MMD2-6389HF
• Product Overview: Human MMD2 full-length ORF ( NP_940685.2, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 246 amino acids
• Description: This gene encodes a member of the PAQR (progestin and adipoQ receptor) family. Members of this family are evolutionarily conserved with significant sequence identity to bacterial hemolysin-like proteins and are defined by a set of seven transmembrane domains. The protein encoded by this gene localizes to the Golgi apparatus to modulate Ras signaling. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]
• Molecular Mass: 55.2 kDa
• AA Sequence: MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLSDDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCIHMFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERYKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPSTLQTKVSK
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MMD2 monocyte to macrophage differentiation-associated 2 [ Homo sapiens ]
• Official Symbol: MMD2
• Synonyms: MMD2; monocyte to macrophage differentiation-associated 2; monocyte to macrophage differentiation factor 2; PAQR10; progestin and adipoQ receptor family member X; progestin and adipoQ receptor family member 10; monocyte-to-macrophage differentiation factor 2; FLJ37205
• Gene ID: 221938
• mRNA Refseq: NM_001100600
• Protein Refseq: NP_001094070
• MIM: 614581
• UniProt ID: Q8IY49