Recombinant Full Length Human MMD2 Protein, GST-tagged

Cat.No. : MMD2-6389HF
Product Overview : Human MMD2 full-length ORF ( NP_940685.2, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 246 amino acids
Description : This gene encodes a member of the PAQR (progestin and adipoQ receptor) family. Members of this family are evolutionarily conserved with significant sequence identity to bacterial hemolysin-like proteins and are defined by a set of seven transmembrane domains. The protein encoded by this gene localizes to the Golgi apparatus to modulate Ras signaling. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]
Molecular Mass : 55.2 kDa
AA Sequence : MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLSDDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCIHMFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERYKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPSTLQTKVSK
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MMD2 monocyte to macrophage differentiation-associated 2 [ Homo sapiens ]
Official Symbol MMD2
Synonyms MMD2; monocyte to macrophage differentiation-associated 2; monocyte to macrophage differentiation factor 2; PAQR10; progestin and adipoQ receptor family member X; progestin and adipoQ receptor family member 10; monocyte-to-macrophage differentiation factor 2; FLJ37205;
Gene ID 221938
mRNA Refseq NM_001100600
Protein Refseq NP_001094070
MIM 614581
UniProt ID Q8IY49

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMD2 Products

Required fields are marked with *

My Review for All MMD2 Products

Required fields are marked with *

0
cart-icon