Recombinant Human MMD2 Protein, GST-tagged
| Cat.No. : | MMD2-5407H |
| Product Overview : | Human MMD2 full-length ORF ( NP_940685.2, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the PAQR (progestin and adipoQ receptor) family. Members of this family are evolutionarily conserved with significant sequence identity to bacterial hemolysin-like proteins and are defined by a set of seven transmembrane domains. The protein encoded by this gene localizes to the Golgi apparatus to modulate Ras signaling. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012] |
| Molecular Mass : | 55.2 kDa |
| AA Sequence : | MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLSDDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCIHMFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERYKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPSTLQTKVSK |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MMD2 monocyte to macrophage differentiation-associated 2 [ Homo sapiens ] |
| Official Symbol | MMD2 |
| Synonyms | MMD2; monocyte to macrophage differentiation-associated 2; monocyte to macrophage differentiation factor 2; PAQR10; progestin and adipoQ receptor family member X; progestin and adipoQ receptor family member 10; monocyte-to-macrophage differentiation factor 2; FLJ37205; |
| Gene ID | 221938 |
| mRNA Refseq | NM_001100600 |
| Protein Refseq | NP_001094070 |
| MIM | 614581 |
| UniProt ID | Q8IY49 |
| ◆ Cell & Tissue Lysates | ||
| MMD2-1120HCL | Recombinant Human MMD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMD2 Products
Required fields are marked with *
My Review for All MMD2 Products
Required fields are marked with *
