Recombinant Full Length Human MOB3A Protein, GST-tagged

Cat.No. : MOB3A-6293HF
Product Overview : Human MOBKL2A full-length ORF ( NP_570719.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 217 amino acids
Description : MOB3A (MOB Kinase Activator 3A) is a Protein Coding gene. An important paralog of this gene is MOB3B.
Molecular Mass : 51.9 kDa
AA Sequence : MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVKEFGLIDTKELEPLKEMTARMCH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOB3A MOB kinase activator 3A [ Homo sapiens (human) ]
Official Symbol MOB3A
Synonyms MOB3A; MOB kinase activator 3A; MOB1C; moblak; MOB-LAK; MOBKL2A; MOB kinase activator 3A; MOB LAK; MOB1, Mps One Binder kinase activator-like 2A; mob1 homolog 2A; mps one binder kinase activator-like 2A
Gene ID 126308
mRNA Refseq NM_130807
Protein Refseq NP_570719
UniProt ID Q96BX8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOB3A Products

Required fields are marked with *

My Review for All MOB3A Products

Required fields are marked with *

0
cart-icon
0
compare icon