Recombinant Human MOB3A Protein, GST-tagged
Cat.No. : | MOB3A-5456H |
Product Overview : | Human MOBKL2A full-length ORF ( NP_570719.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MOB3A (MOB Kinase Activator 3A) is a Protein Coding gene. An important paralog of this gene is MOB3B. |
Molecular Mass : | 51.9 kDa |
AA Sequence : | MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVKEFGLIDTKELEPLKEMTARMCH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOB3A MOB kinase activator 3A [ Homo sapiens (human) ] |
Official Symbol | MOB3A |
Synonyms | MOB3A; MOB kinase activator 3A; MOB1C; moblak; MOB-LAK; MOBKL2A; MOB kinase activator 3A; MOB LAK; MOB1, Mps One Binder kinase activator-like 2A; mob1 homolog 2A; mps one binder kinase activator-like 2A |
Gene ID | 126308 |
mRNA Refseq | NM_130807 |
Protein Refseq | NP_570719 |
UniProt ID | Q96BX8 |
◆ Recombinant Proteins | ||
Mob3a-4106M | Recombinant Mouse Mob3a Protein, Myc/DDK-tagged | +Inquiry |
MOB3A-10112Z | Recombinant Zebrafish MOB3A | +Inquiry |
MOB3A-5619M | Recombinant Mouse MOB3A Protein, His (Fc)-Avi-tagged | +Inquiry |
MOB3A-5456H | Recombinant Human MOB3A Protein, GST-tagged | +Inquiry |
MOB3A-9943M | Recombinant Mouse MOB3A Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOB3A Products
Required fields are marked with *
My Review for All MOB3A Products
Required fields are marked with *