Recombinant Full Length Human MOB3C Protein, GST-tagged
| Cat.No. : | MOB3C-6295HF |
| Product Overview : | Human MOBKL2C full-length ORF ( NP_958805.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 216 amino acids |
| Description : | The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq |
| Molecular Mass : | 52 kDa |
| AA Sequence : | MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MOB3C MOB kinase activator 3C [ Homo sapiens (human) ] |
| Official Symbol | MOB3C |
| Synonyms | MOB3C; MOB kinase activator 3C; MOB1E; MOBKL2C; MOB kinase activator 3C; MOB1, Mps One Binder kinase activator-like 2C; mob1 homolog 2C |
| Gene ID | 148932 |
| mRNA Refseq | NM_145279 |
| Protein Refseq | NP_660322 |
| UniProt ID | Q70IA8 |
| ◆ Recombinant Proteins | ||
| MOB3C-409Z | Recombinant Zebrafish MOB3C | +Inquiry |
| MOB3C-6295HF | Recombinant Full Length Human MOB3C Protein, GST-tagged | +Inquiry |
| MOB3C-2621R | Recombinant Rhesus Macaque MOB3C Protein, His (Fc)-Avi-tagged | +Inquiry |
| MOB3C-5953H | Recombinant Human MOB3C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MOB3C-5458H | Recombinant Human MOB3C Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOB3C-1125HCL | Recombinant Human MOB3C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOB3C Products
Required fields are marked with *
My Review for All MOB3C Products
Required fields are marked with *
