Recombinant Human MOB3C Protein, GST-tagged

• Cat.No.: MOB3C-5458H
• Product Overview: Human MOBKL2C full-length ORF ( NP_958805.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
• Molecular Mass: 52 kDa
• AA Sequence: MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOB3C MOB kinase activator 3C [ Homo sapiens (human) ]
• Official Symbol: MOB3C
• Synonyms: MOB3C; MOB kinase activator 3C; MOB1E; MOBKL2C; MOB kinase activator 3C; MOB1, Mps One Binder kinase activator-like 2C; mob1 homolog 2C
• Gene ID: 148932
• mRNA Refseq: NM_145279
• Protein Refseq: NP_660322
• UniProt ID: Q70IA8