Recombinant Full Length Human MOBKL1A Protein, GST-tagged
| Cat.No. : | MOBKL1A-6291HF |
| Product Overview : | Human MOBKL1A full-length ORF ( NP_775739.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 216 amino acids |
| Description : | The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. [provided by RefSeq |
| Molecular Mass : | 51.5 kDa |
| AA Sequence : | MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MOB1B MOB kinase activator 1B [ Homo sapiens (human) ] |
| Official Symbol | MOBKL1A |
| Synonyms | MOB1B; MATS2; MOB4A; MOBKL1A; MOB kinase activator 1B; mob1A; mob1 homolog 1A; MOB1 Mps One Binder homolog B; mps one binder kinase activator-like 1A; MOB1, Mps One Binder kinase activator-like 1A |
| Gene ID | 92597 |
| mRNA Refseq | NM_001244766 |
| Protein Refseq | NP_001231695 |
| MIM | 609282 |
| UniProt ID | Q7L9L4 |
| ◆ Recombinant Proteins | ||
| MOBKL1A-927H | Recombinant Human MOBKL1A, GST-tagged | +Inquiry |
| MOBKL1A-5453H | Recombinant Human MOBKL1A Protein, GST-tagged | +Inquiry |
| MOBKL1A-6291HF | Recombinant Full Length Human MOBKL1A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOBKL1A-4266HCL | Recombinant Human MOBKL1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOBKL1A Products
Required fields are marked with *
My Review for All MOBKL1A Products
Required fields are marked with *
