Recombinant Full Length Human MOBKL1A Protein, GST-tagged

Cat.No. : MOBKL1A-6291HF
Product Overview : Human MOBKL1A full-length ORF ( NP_775739.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 216 amino acids
Description : The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. [provided by RefSeq
Molecular Mass : 51.5 kDa
AA Sequence : MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOB1B MOB kinase activator 1B [ Homo sapiens (human) ]
Official Symbol MOBKL1A
Synonyms MOB1B; MATS2; MOB4A; MOBKL1A; MOB kinase activator 1B; mob1A; mob1 homolog 1A; MOB1 Mps One Binder homolog B; mps one binder kinase activator-like 1A; MOB1, Mps One Binder kinase activator-like 1A
Gene ID 92597
mRNA Refseq NM_001244766
Protein Refseq NP_001231695
MIM 609282
UniProt ID Q7L9L4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOBKL1A Products

Required fields are marked with *

My Review for All MOBKL1A Products

Required fields are marked with *

0
cart-icon