Recombinant Human MOBKL1A Protein, GST-tagged
Cat.No. : | MOBKL1A-5453H |
Product Overview : | Human MOBKL1A full-length ORF ( NP_775739.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. [provided by RefSeq |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOB1B MOB kinase activator 1B [ Homo sapiens (human) ] |
Official Symbol | MOBKL1A |
Synonyms | MOB1B; MATS2; MOB4A; MOBKL1A; MOB kinase activator 1B; mob1A; mob1 homolog 1A; MOB1 Mps One Binder homolog B; mps one binder kinase activator-like 1A; MOB1, Mps One Binder kinase activator-like 1A |
Gene ID | 92597 |
mRNA Refseq | NM_001244766 |
Protein Refseq | NP_001231695 |
MIM | 609282 |
UniProt ID | Q7L9L4 |
◆ Recombinant Proteins | ||
MOBKL1A-6291HF | Recombinant Full Length Human MOBKL1A Protein, GST-tagged | +Inquiry |
MOBKL1A-927H | Recombinant Human MOBKL1A, GST-tagged | +Inquiry |
MOBKL1A-5453H | Recombinant Human MOBKL1A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOBKL1A-4266HCL | Recombinant Human MOBKL1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOBKL1A Products
Required fields are marked with *
My Review for All MOBKL1A Products
Required fields are marked with *